PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016481564.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 75aa    MW: 8588.36 Da    PI: 4.1323
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016481564.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.23.9e-132869346
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                      ++++E+el+++  ++lG + W++Ia +++ gRt++++  +w++
   XP_016481564.1 28 EFSQDEEELIIRMYNLLGER-WSLIAGRIP-GRTAEEIEKYWNT 69
                     69******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.7782175IPR017930Myb domain
SMARTSM007172.2E-102573IPR001005SANT/Myb domain
SuperFamilySSF466895.15E-102770IPR009057Homeodomain-like
CDDcd001674.98E-102869No hitNo description
Gene3DG3DSA:1.10.10.606.3E-162870IPR009057Homeodomain-like
PfamPF002499.4E-122869IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 75 aa     Download sequence    Send to blast
MADSEQLSSS DYTPPDSQGK ISKEAETEFS QDEEELIIRM YNLLGERWSL IAGRIPGRTA  60
EEIEKYWNTR SSTSQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009607344.12e-48PREDICTED: MYB-like transcription factor ETC1
RefseqXP_016481564.12e-48PREDICTED: MYB-like transcription factor ETC1
SwissprotQ9LNI51e-17ETC1_ARATH; MYB-like transcription factor ETC1
TrEMBLM1C8621e-34M1C862_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000618643e-34(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA65791932
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01380.16e-19MYB_related family protein